Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Leptin receptor gene-related protein (leprot)

This Recombinant Danio rerio Leptin receptor gene-related protein (leprot) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

Q561T9

Expression Region

1-130

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALVALSFSGALGLTFLLLGCALEQFGQYWPMFVLIFYILSPIPNLIARRHADDTE SSNACRELAYFLTTGIVVSAYGLPVVLARKAVIQWGAAGLVMAGNCVIFLTILGFFLIFG GGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sprouty 3 (SPRY3) Rabbit Polyclonal Antibody
TA381966 100 µL

Sprouty 3 (SPRY3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein
TP304895M 100 µg

p15 INK4b (CDKN2B) (NM_004936) Human Recombinant Protein

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF405S conjugate, 0.1mg/mL
BNC042383-100 1x 100 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human LEPR/CD295 Protein (His & Fc Tag)
PKSH031689-01 100 µg

Recombinant Human LEPR/CD295 Protein (His & Fc Tag)

Sign In for Pricing
View Details
Recombinant Human LEPR/CD295 Protein (His & Fc Tag)
PKSH031689-02 1 mg

Recombinant Human LEPR/CD295 Protein (His & Fc Tag)

Sign In for Pricing
View Details
WAVE-2 Antibody
KC-28903-01 50 μL

WAVE-2 Antibody

Sign In for Pricing
View Details