Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Leptin receptor gene-related protein (leprot)

This Recombinant Danio rerio Leptin receptor gene-related protein (leprot) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

Q561T9

Expression Region

1-130

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALVALSFSGALGLTFLLLGCALEQFGQYWPMFVLIFYILSPIPNLIARRHADDTE SSNACRELAYFLTTGIVVSAYGLPVVLARKAVIQWGAAGLVMAGNCVIFLTILGFFLIFG GGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PANK1 (Center) Rabbit Polyclonal Antibody
AP13803PU-N 400 µL

PANK1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytl1 (NM_001081106) Mouse Recombinant Protein
TP521433 20 µg

Cytl1 (NM_001081106) Mouse Recombinant Protein

Sign In for Pricing
View Details
RPL5 (NM_000969) Human Over-expression Lysate
LC400352 20 µg

RPL5 (NM_000969) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Ephrin-B2/EFNB2 Protein (His Tag)
PKSH032395-01 10 µg

Recombinant Human Ephrin-B2/EFNB2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Ephrin-B2/EFNB2 Protein (His Tag)
PKSH032395-02 50 µg

Recombinant Human Ephrin-B2/EFNB2 Protein (His Tag)

Sign In for Pricing
View Details
Cibacron Brilliant Yellow 3G-P, Technical Grade
TRC-C535733-5G 5 g

Cibacron Brilliant Yellow 3G-P, Technical Grade

Sign In for Pricing
View Details