Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Leptin receptor gene-related protein (leprot)

This Recombinant Danio rerio Leptin receptor gene-related protein (leprot) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

Q561T9

Expression Region

1-130

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALVALSFSGALGLTFLLLGCALEQFGQYWPMFVLIFYILSPIPNLIARRHADDTE SSNACRELAYFLTTGIVVSAYGLPVVLARKAVIQWGAAGLVMAGNCVIFLTILGFFLIFG GGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PATL2 (NM_001145112) Human Over-expression Lysate
LY428698 100 µg

PATL2 (NM_001145112) Human Over-expression Lysate

Sign In for Pricing
View Details
Pif1 Mouse Gene Knockout Kit (CRISPR)
KN513262 1 Kit

Pif1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vmn1r30 Mouse Gene Knockout Kit (CRISPR)
KN519042 1 Kit

Vmn1r30 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C1orf189 (NM_001010979) Human Recombinant Protein
TP313767M 100 µg

C1orf189 (NM_001010979) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560269 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
VC Lambda / Hind III Marker, 5 x 50µg
NM2406 5 x 50μg

VC Lambda / Hind III Marker, 5 x 50µg

Sign In for Pricing
View Details