Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q7V9N5

Expression Region

1-130

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDGLSTYKSFFLVAFGAVPGAICRMKISDNLFRNKHNLWGILLVNSSACLLLGFFLAKQ NYIHYINNDQPLYLLLCVGFLGSFSTFSSLILEIYYLFVDQQWMELFLFTFTSIGLGIIF ISLGSHLFNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

d-cis-Phenothrin-d5
TRC-P318101-2.5MG 2.5 mg

d-cis-Phenothrin-d5

Sign In for Pricing
View Details
Human Lambda Light Chain (Lamb14), CF640R conjugate, 0.1mg/mL
BNC400860-500 1x 500 µL

Human Lambda Light Chain (Lamb14), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
AP02614PU-N 100 µL

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD48 Antibody[156-4H9]
E-AB-F1061P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD48 Antibody[156-4H9]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD48 Antibody[156-4H9]
E-AB-F1061P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD48 Antibody[156-4H9]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD48 Antibody[156-4H9]
E-AB-F1061P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Human CD48 Antibody[156-4H9]

Sign In for Pricing
View Details