Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q7V9N5

Expression Region

1-130

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDGLSTYKSFFLVAFGAVPGAICRMKISDNLFRNKHNLWGILLVNSSACLLLGFFLAKQ NYIHYINNDQPLYLLLCVGFLGSFSTFSSLILEIYYLFVDQQWMELFLFTFTSIGLGIIF ISLGSHLFNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD22 / BL-CAM (B-Cell Marker) (RFB4), 1mg/mL
BNUM1594-50 1x 50 µL

CD22 / BL-CAM (B-Cell Marker) (RFB4), 1mg/mL

Sign In for Pricing
View Details
Laminin gamma 1 (LAMC1) Rabbit Polyclonal Antibody
AP20488PU-N 100 µg

Laminin gamma 1 (LAMC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF640R conjugate, 0.1mg/mL
BNC402343-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-(4-Chlorophenyl)-1-(4H-1,2,4-triazol-4-yl)butan-2-one
TRC-C377910-50MG 50 mg

4-(4-Chlorophenyl)-1-(4H-1,2,4-triazol-4-yl)butan-2-one

Sign In for Pricing
View Details
Tedizolid Phosphate
TRC-T013755-1MG 1 mg

Tedizolid Phosphate

Sign In for Pricing
View Details
Rat Claudin 3 (CLDN3) ELISA Kit
RDR-CLDN3-Ra-01 96 Tests

Rat Claudin 3 (CLDN3) ELISA Kit

Sign In for Pricing
View Details