Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

P60648

Expression Region

1-131

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® MB SH
MB160004.0.1G 1 g

TentaGel® MB SH

Sign In for Pricing
View Details
Human TMPRSS11E activation kit by CRISPRa
GA109188 1 Kit

Human TMPRSS11E activation kit by CRISPRa

Sign In for Pricing
View Details
Wnt2b Mouse Gene Knockout Kit (CRISPR)
KN519451 1 Kit

Wnt2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p21 Ras (HRAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]
TA505674BM 100 µL

p21 Ras (HRAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]

Sign In for Pricing
View Details
Recombinant Estrogen Receptor alpha Antibody
RC-16778-01 50 μL

Recombinant Estrogen Receptor alpha Antibody

Sign In for Pricing
View Details
Recombinant Estrogen Receptor alpha Antibody
RC-16778-02 100 µL

Recombinant Estrogen Receptor alpha Antibody

Sign In for Pricing
View Details