Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

P60647

Expression Region

1-131

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-NR1H4-sgRNA2-Cas9-Puro Plasmid
PVT73721 2 µg

PLV3-U6-NR1H4-sgRNA2-Cas9-Puro Plasmid

Sign In for Pricing
View Details
WLS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV654645 1.0 µg DNA

WLS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant eEF1A2 Monoclonal Antibody
AN301979L-01 50 µL

Recombinant eEF1A2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant eEF1A2 Monoclonal Antibody
AN301979L-02 100 µL

Recombinant eEF1A2 Monoclonal Antibody

Sign In for Pricing
View Details
ARH (LDLRAP1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI4B10]
TA700148 50 µg

ARH (LDLRAP1) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI4B10]

Sign In for Pricing
View Details
Mouse GAP43 ELISA Kit
E054885 1 Each

Mouse GAP43 ELISA Kit

Sign In for Pricing
View Details