Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

P60647

Expression Region

1-131

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[KO Validated] MAPK6 Rabbit pAb
E45R21860N-100 100 µL

[KO Validated] MAPK6 Rabbit pAb

Sign In for Pricing
View Details
Rat Paraoxonase-2 (PON-2) ELISA Kit
CK-bio-15120-01 48 Tests

Rat Paraoxonase-2 (PON-2) ELISA Kit

Sign In for Pricing
View Details
Rat Paraoxonase-2 (PON-2) ELISA Kit
CK-bio-15120-02 96 Tests

Rat Paraoxonase-2 (PON-2) ELISA Kit

Sign In for Pricing
View Details
Rat Paraoxonase-2 (PON-2) ELISA Kit
CK-bio-15120-03 5x 96 Tests

Rat Paraoxonase-2 (PON-2) ELISA Kit

Sign In for Pricing
View Details
Rat Paraoxonase-2 (PON-2) ELISA Kit
CK-bio-15120-04 10x 96 Tests

Rat Paraoxonase-2 (PON-2) ELISA Kit

Sign In for Pricing
View Details
pCR-BluntII-TOPO-SP140 Plasmid
PVT30225 2 µg

pCR-BluntII-TOPO-SP140 Plasmid

Sign In for Pricing
View Details