Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

A5IVW8

Expression Region

1-131

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acid Orange 3, Technical Grade
TRC-A189883-50G 50 g

Acid Orange 3, Technical Grade

Sign In for Pricing
View Details
CD104 (UM-A9), CF568 conjugate, 0.1mg/mL
BNC680449-500 1x 500 µL

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFluor® 790-Wheat Germ Agglutinin (WGA) Conjugate
25563-AAT 1 mg

IFluor® 790-Wheat Germ Agglutinin (WGA) Conjugate

Sign In for Pricing
View Details
Uncoated Human MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-UNEL-H0212-01 5x 96 Tests

Uncoated Human MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-UNEL-H0212-02 15x 96 Tests

Uncoated Human MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
N-(4,5-Dihydro-1H-imidazol-2-yl)-2,1,3-benzothiadiazol-4-amine
TRC-D453090-10MG 10 mg

N-(4,5-Dihydro-1H-imidazol-2-yl)-2,1,3-benzothiadiazol-4-amine

Sign In for Pricing
View Details