Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

A5IVW8

Expression Region

1-131

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CaMKII Recombinant Rabbit monoclonal Antibody
HA750150 100 µL

CaMKII Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
(3alpha,5alpha)-13-Ethyl-3-hydroxygonan-17-one
TRC-E368180-100MG 100 mg

(3alpha,5alpha)-13-Ethyl-3-hydroxygonan-17-one

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF740 conjugate, 0.1mg/mL
BNC742383-100 1x 100 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Picropodophyllotoxin-d3
TRC-P437622-1MG 1 mg

Picropodophyllotoxin-d3

Sign In for Pricing
View Details
Prmt9 Mouse Gene Knockout Kit (CRISPR)
KN513934 1 Kit

Prmt9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Angiopoietin like 7 (ANGPTL7) Human Gene Knockout Kit (CRISPR)
KN400321 1 Kit

Angiopoietin like 7 (ANGPTL7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details