Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

A6QK30

Expression Region

1-131

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SREBP1 Mouse mAb
C05939-20uL 20 µL

SREBP1 Mouse mAb

Sign In for Pricing
View Details
Rat Arrestin domain containing protein 3 (ARRDC3) ELISA kit
GTR10378442 96 Well

Rat Arrestin domain containing protein 3 (ARRDC3) ELISA kit

Sign In for Pricing
View Details
Polyclonal Cathepsin L Antibody
AMM05698G 0.1ml

Polyclonal Cathepsin L Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB605776 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
CDX4 (Caudal Type Homeobox 4) (MaxLight 405) discontinued
244568-ML405 100 µL

CDX4 (Caudal Type Homeobox 4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human NAAA Knockout A549 cell line
GTR15405104 1 Vial

Human NAAA Knockout A549 cell line

Sign In for Pricing
View Details