Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

A6QK30

Expression Region

1-131

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Twist-related protein 1 (TWIST1) Elisa Kit
EK731791 96 Well

Mouse Twist-related protein 1 (TWIST1) Elisa Kit

Sign In for Pricing
View Details
Human Thyroid Transcription Factor 1 (TTF1) ELISA Kit
JL17071-01 48 Tests

Human Thyroid Transcription Factor 1 (TTF1) ELISA Kit

Sign In for Pricing
View Details
Human Thyroid Transcription Factor 1 (TTF1) ELISA Kit
JL17071-02 96 Tests

Human Thyroid Transcription Factor 1 (TTF1) ELISA Kit

Sign In for Pricing
View Details
Blmh sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
13343116 3x 1.0 µg

Blmh sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Fgf19 Rat shRNA Plasmid (Locus ID 170582)
TL712546 1 Kit

Fgf19 Rat shRNA Plasmid (Locus ID 170582)

Sign In for Pricing
View Details
POU3F2 Human siRNA Oligo Duplex (Locus ID 5454)
SR303643 1 Kit

POU3F2 Human siRNA Oligo Duplex (Locus ID 5454)

Sign In for Pricing
View Details