Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

A6QK30

Expression Region

1-131

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAT-NSF700 Fusion Peptide
orb1943730-01 5 mg

TAT-NSF700 Fusion Peptide

Sign In for Pricing
View Details
TAT-NSF700 Fusion Peptide
orb1943730-02 50 mg

TAT-NSF700 Fusion Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal S100A7/Psoriasin Antibody
NBP2-99720-100ul 100 µL

Rabbit Polyclonal S100A7/Psoriasin Antibody

Sign In for Pricing
View Details
5-tert-Butyl-1,3-benzoxazole-2-thiol
sc-319064 500 mg

5-tert-Butyl-1,3-benzoxazole-2-thiol

Sign In for Pricing
View Details
USH2A Protein (N-Human Fc tag, )
P512450 100 µg

USH2A Protein (N-Human Fc tag, )

Sign In for Pricing
View Details
Cyanuric Chloride discontinued
163226 1 g

Cyanuric Chloride discontinued

Sign In for Pricing
View Details