Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

A6U4S2

Expression Region

1-131

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Empty solid load cartridge with screw cap, frits, disbursing unit, tips and O-ring,80g
12031006 10 PCS

Empty solid load cartridge with screw cap, frits, disbursing unit, tips and O-ring,80g

Sign In for Pricing
View Details
Rat NRD1 siRNA
abx926381-01 15 nmol

Rat NRD1 siRNA

Sign In for Pricing
View Details
Rat NRD1 siRNA
abx926381-02 30 nmol

Rat NRD1 siRNA

Sign In for Pricing
View Details
DEFB125 (NM_153325) Human Tagged ORF Clone Lentiviral Particle
RC212030L4V 200 µL

DEFB125 (NM_153325) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal VMAT2 Antibody
NBP2-68952-25ul 25 µL

Rabbit Polyclonal VMAT2 Antibody

Sign In for Pricing
View Details
Coumarin 102
sc-294103 1 g

Coumarin 102

Sign In for Pricing
View Details