Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

A6U4S2

Expression Region

1-131

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCERG1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-6801R-APC-Cy5.5 100 µL

TCERG1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
IDL4 Antibody
orb791038 2 mg

IDL4 Antibody

Sign In for Pricing
View Details
BMIQ2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV719734 1.0 µg DNA

BMIQ2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Cell division protein FtsL (ftsL), partial
MBS1075426-01 1 mg (E-Coli)

Recombinant Haemophilus influenzae Cell division protein FtsL (ftsL), partial

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Cell division protein FtsL (ftsL), partial
MBS1075426-02 1 mg (Yeast)

Recombinant Haemophilus influenzae Cell division protein FtsL (ftsL), partial

Sign In for Pricing
View Details
Histone H2AX Antibody
orb2683940-01 50 µL

Histone H2AX Antibody

Sign In for Pricing
View Details