Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

A8Z3D9

Expression Region

1-131

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL4 Human shRNA Plasmid Kit (Locus ID 6124)
TR309740 1 Kit

RPL4 Human shRNA Plasmid Kit (Locus ID 6124)

Sign In for Pricing
View Details
PRICKLE4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1719605 3x 1.0 µg

PRICKLE4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SLC27A4 Rabbit Polyclonal Antibody (APC)
orb999583 100 µL

SLC27A4 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
PRR21 Protein Vector (Human) (pPM-C-His)
PV113473 500 ng

PRR21 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
C/EBP β CRISPR Activation Plasmid (h)
sc-400125-ACT 20 µg

C/EBP β CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae rpsM Protein (aa 1-118) (strain PittEE)
VAng-Lsx03826-50gEcoli 50 µg (E. coli)

Recombinant Haemophilus Influenzae rpsM Protein (aa 1-118) (strain PittEE)

Sign In for Pricing
View Details