Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

A8Z3D9

Expression Region

1-131

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Gastric Inhibitory Polypeptide (GIP)
TRV-0045253-01 20 µL

Polyclonal Antibody to Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details
Polyclonal Antibody to Gastric Inhibitory Polypeptide (GIP)
TRV-0045253-02 100 µL

Polyclonal Antibody to Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details
Polyclonal Antibody to Gastric Inhibitory Polypeptide (GIP)
TRV-0045253-03 200 µL

Polyclonal Antibody to Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details
Polyclonal Antibody to Gastric Inhibitory Polypeptide (GIP)
TRV-0045253-04 1 mL

Polyclonal Antibody to Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details
Culture Medium for Human Gastric Cancer Cell [IM-95M]
AFG-ELL-2616-01 125 mL

Culture Medium for Human Gastric Cancer Cell [IM-95M]

Sign In for Pricing
View Details
Culture Medium for Human Gastric Cancer Cell [IM-95M]
AFG-ELL-2616-02 500 mL

Culture Medium for Human Gastric Cancer Cell [IM-95M]

Sign In for Pricing
View Details