Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus carnosus UPF0344 protein Sca_0577 (Sca_0577)

This Recombinant Staphylococcus carnosus UPF0344 protein Sca_0577 (Sca_0577) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

UPF0344 protein Sca_0577

UniProt

B9DIS4

Expression Region

1-131

Origin

Staphylococcus carnosus (strain TM300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHIFSWVIGIILFIVSYISFTKTGAPKKAYKPLHMTLRLFLVLILFSGVWQVVEEFA TATGSTHMLLTLKMICGIGVVALMEVTLVRKQRGASHKGLFWGTIALIIVTMALGIILPG GPISNMFVITK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABR Rabbit Polyclonal Antibody
TA367726 100 µL

ABR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LZCap AU (3'Acm), High Affinity (100mM)
10685ES80 1 mL

LZCap AU (3'Acm), High Affinity (100mM)

Sign In for Pricing
View Details
ROR-gamma / RORC (RAR-related Orphan Receptor C) (RORC/2942), CF640R conjugate, 0.1mg/mL
BNC402942-500 1x 500 µL

ROR-gamma / RORC (RAR-related Orphan Receptor C) (RORC/2942), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL 2 Human
OM296650-01 10 µg

IL 2 Human

Sign In for Pricing
View Details
IL 2 Human
OM296650-02 50 µg

IL 2 Human

Sign In for Pricing
View Details
IL 2 Human
OM296650-03 1 mg

IL 2 Human

Sign In for Pricing
View Details