Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus carnosus UPF0344 protein Sca_0577 (Sca_0577)

This Recombinant Staphylococcus carnosus UPF0344 protein Sca_0577 (Sca_0577) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

UPF0344 protein Sca_0577

UniProt

B9DIS4

Expression Region

1-131

Origin

Staphylococcus carnosus (strain TM300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHIFSWVIGIILFIVSYISFTKTGAPKKAYKPLHMTLRLFLVLILFSGVWQVVEEFA TATGSTHMLLTLKMICGIGVVALMEVTLVRKQRGASHKGLFWGTIALIIVTMALGIILPG GPISNMFVITK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3135R), CF740 conjugate, 0.1mg/mL
BNC743135-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3135R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E2F3 Rabbit Polyclonal Antibody
TA367560 100 µL

E2F3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD45RB (PTPRC/1147), 1mg/mL
BNUM1147-50 1x 50 µL

CD45RB (PTPRC/1147), 1mg/mL

Sign In for Pricing
View Details
LIN28A Antibody
KC-6335-01 50 μL

LIN28A Antibody

Sign In for Pricing
View Details
LIN28A Antibody
KC-6335-02 100 µL

LIN28A Antibody

Sign In for Pricing
View Details
LIN28A Antibody
KC-6335-03 1 mL

LIN28A Antibody

Sign In for Pricing
View Details