Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus carnosus UPF0344 protein Sca_0577 (Sca_0577)

This Recombinant Staphylococcus carnosus UPF0344 protein Sca_0577 (Sca_0577) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

UPF0344 protein Sca_0577

UniProt

B9DIS4

Expression Region

1-131

Origin

Staphylococcus carnosus (strain TM300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHLHIFSWVIGIILFIVSYISFTKTGAPKKAYKPLHMTLRLFLVLILFSGVWQVVEEFA TATGSTHMLLTLKMICGIGVVALMEVTLVRKQRGASHKGLFWGTIALIIVTMALGIILPG GPISNMFVITK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR32 (NM_001506) Human Over-expression Lysate
LC400579 20 µg

GPR32 (NM_001506) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF237 (ZMYM5) (NM_001039650) Human Over-expression Lysate
LY422098 100 µg

ZNF237 (ZMYM5) (NM_001039650) Human Over-expression Lysate

Sign In for Pricing
View Details
ReadiCleave™ SSL biotin NHS ester
3030-AAT 5 mg

ReadiCleave™ SSL biotin NHS ester

Sign In for Pricing
View Details
Dioctyl Terepthalate-d4
TRC-D481852-5MG 5 mg

Dioctyl Terepthalate-d4

Sign In for Pricing
View Details
CITED1 Mouse Monoclonal Antibody [Clone ID: OTI4H4]
CF807050 100 µg

CITED1 Mouse Monoclonal Antibody [Clone ID: OTI4H4]

Sign In for Pricing
View Details
Human GATD1 activation kit by CRISPRa
GA117668 1 Kit

Human GATD1 activation kit by CRISPRa

Sign In for Pricing
View Details