Recombinant Pongo abelii Leptin receptor overlapping transcript-like 1 (LEPROTL1)
This Recombinant Pongo abelii Leptin receptor overlapping transcript-like 1 (LEPROTL1) spans the amino acid sequence from region 1-131.
Product Specifications
Product Name Alternative
Leptin receptor overlapping transcript-like 1
UniProt
Q5RDE9
Expression Region
1-131
Origin
Pongo abelii (Sumatran orangutan)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6317163-01 0.2 mL
LRRC45, CT (LRRC45, Leucine-rich repeat-containing protein 45) (PE)
Sign In for Pricing
View Details MBS6317163-02 5x 0.2 mL
LRRC45, CT (LRRC45, Leucine-rich repeat-containing protein 45) (PE)
Sign In for Pricing
View Details 
T1032-74B 40 µg
Tau (Ser422) (Tau Protein, Microtubule-associated Protein, MAP) discontinued
Sign In for Pricing
View Details