Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Leptin receptor overlapping transcript-like 1 (LEPROTL1)

This Recombinant Pongo abelii Leptin receptor overlapping transcript-like 1 (LEPROTL1) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor overlapping transcript-like 1

UniProt

Q5RDE9

Expression Region

1-131

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-COL8A2 Antibody Fluoro647 Conjugated
A05649-1-Fluoro647 100 µg/Vial

Anti-COL8A2 Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Human Opsin-3 (OPN3)
MBS7024564-01 0.02 mg (E-Coli)

Recombinant Human Opsin-3 (OPN3)

Sign In for Pricing
View Details
Recombinant Human Opsin-3 (OPN3)
MBS7024564-02 0.1 mg (E-Coli)

Recombinant Human Opsin-3 (OPN3)

Sign In for Pricing
View Details
Recombinant Human Opsin-3 (OPN3)
MBS7024564-03 5x 0.1 mg (E-Coli)

Recombinant Human Opsin-3 (OPN3)

Sign In for Pricing
View Details
Slc16a3 3'UTR Luciferase Stable Cell Line
TU118921 1.0 mL

Slc16a3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
eIF3A Rabbit mAb
MBS9469362-01 0.05 mL

eIF3A Rabbit mAb

Sign In for Pricing
View Details