Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Leptin receptor overlapping transcript-like 1 (LEPROTL1)

This Recombinant Pongo abelii Leptin receptor overlapping transcript-like 1 (LEPROTL1) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor overlapping transcript-like 1

UniProt

Q5RDE9

Expression Region

1-131

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPC6 Rabbit Polyclonal Antibody (AP)
orb1595956 100 µL

TRPC6 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Di-n-butyl phthalate 1000ug/mL in MeOH - 1ML
REPHT019 1 mL

Di-n-butyl phthalate 1000ug/mL in MeOH - 1ML

Sign In for Pricing
View Details
Compound STOCK1N-52663
T127017-01 10 mg

Compound STOCK1N-52663

Sign In for Pricing
View Details
Compound STOCK1N-52663
T127017-02 1 g

Compound STOCK1N-52663

Sign In for Pricing
View Details
Compound STOCK1N-52663
T127017-03 1 mg

Compound STOCK1N-52663

Sign In for Pricing
View Details
Compound STOCK1N-52663
T127017-04 50 mg

Compound STOCK1N-52663

Sign In for Pricing
View Details