Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leptin receptor overlapping transcript-like 1 (Leprotl1)

This Recombinant Mouse Leptin receptor overlapping transcript-like 1 (Leprotl1) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor overlapping transcript-like 1

UniProt

Q9CQ74

Expression Region

1-131

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPVVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Thymopentin ELISA Kit
MBS7214138-01 48 Well

Porcine Thymopentin ELISA Kit

Sign In for Pricing
View Details
Porcine Thymopentin ELISA Kit
MBS7214138-02 96 Well

Porcine Thymopentin ELISA Kit

Sign In for Pricing
View Details
Porcine Thymopentin ELISA Kit
MBS7214138-03 5x 96 Well

Porcine Thymopentin ELISA Kit

Sign In for Pricing
View Details
Porcine Thymopentin ELISA Kit
MBS7214138-04 10x 96 Well

Porcine Thymopentin ELISA Kit

Sign In for Pricing
View Details
[2-Amino-1- (4-fluorophenyl) ethyl]dimethylamine
SIB95471-01 1 g

[2-Amino-1- (4-fluorophenyl) ethyl]dimethylamine

Sign In for Pricing
View Details
[2-Amino-1- (4-fluorophenyl) ethyl]dimethylamine
SIB95471-02 10 g

[2-Amino-1- (4-fluorophenyl) ethyl]dimethylamine

Sign In for Pricing
View Details