Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leptin receptor overlapping transcript-like 1 (Leprotl1)

This Recombinant Mouse Leptin receptor overlapping transcript-like 1 (Leprotl1) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor overlapping transcript-like 1

UniProt

Q9CQ74

Expression Region

1-131

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPVVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT23 Rabbit Polyclonal Antibody (Cy3)
orb974134 100 µL

KRT23 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
GTF2H3 Rabbit Polyclonal Antibody
orb573798 100 µL

GTF2H3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
INTS7 Rabbit pAb
orb2718365-01 50 µL

INTS7 Rabbit pAb

Sign In for Pricing
View Details
INTS7 Rabbit pAb
orb2718365-02 100 µL

INTS7 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral human AP1G2 sgRNA gene knockout kit - Lentiviral human AP1G2 sgRNA gene knockout kit (plasmid)
GTR15387128 1 Vial

Lentiviral human AP1G2 sgRNA gene knockout kit - Lentiviral human AP1G2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
β-Amyloid Precursor Protein (MaxLight 650)
A2275-87F-ML650 100 µL

β-Amyloid Precursor Protein (MaxLight 650)

Sign In for Pricing
View Details