Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leptin receptor overlapping transcript-like 1 (Leprotl1)

This Recombinant Mouse Leptin receptor overlapping transcript-like 1 (Leprotl1) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor overlapping transcript-like 1

UniProt

Q9CQ74

Expression Region

1-131

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPVVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Candida glabrata Inheritance of peroxisomes protein 2 (INP2)
MBS7017488-01 0.02 mg

Recombinant Candida glabrata Inheritance of peroxisomes protein 2 (INP2)

Sign In for Pricing
View Details
Recombinant Candida glabrata Inheritance of peroxisomes protein 2 (INP2)
MBS7017488-02 0.1 mg

Recombinant Candida glabrata Inheritance of peroxisomes protein 2 (INP2)

Sign In for Pricing
View Details
Recombinant Candida glabrata Inheritance of peroxisomes protein 2 (INP2)
MBS7017488-03 5x 0.1 mg

Recombinant Candida glabrata Inheritance of peroxisomes protein 2 (INP2)

Sign In for Pricing
View Details
4,4-Dimethyl-2-phenylpyrrolidine hydrochloride
JBD31389-01 50 mg

4,4-Dimethyl-2-phenylpyrrolidine hydrochloride

Sign In for Pricing
View Details
4,4-Dimethyl-2-phenylpyrrolidine hydrochloride
JBD31389-02 0.5 g

4,4-Dimethyl-2-phenylpyrrolidine hydrochloride

Sign In for Pricing
View Details
Spatula, Palette Knife, Stainless Steel
2066450/4 1 Each

Spatula, Palette Knife, Stainless Steel

Sign In for Pricing
View Details