Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Leptin receptor overlapping transcript-like 1 (LEPROTL1)

This Recombinant Bovine Leptin receptor overlapping transcript-like 1 (LEPROTL1) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor overlapping transcript-like 1

UniProt

Q32PD8

Expression Region

1-131

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARANLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-Lys(2-chloro-Z)-OSu
A-3515.0025 25.0g

Boc-Lys(2-chloro-Z)-OSu

Sign In for Pricing
View Details
LYG2 (NM_175735) Human Over-expression Lysate
LS254773-100ug 100 µg

LYG2 (NM_175735) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Annexin A4 (ANXA4) Antibody Pair Kit (with Standard)
MBS2103183-01 5x 96 Tests

Human Annexin A4 (ANXA4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Annexin A4 (ANXA4) Antibody Pair Kit (with Standard)
MBS2103183-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Annexin A4 (ANXA4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Annexin A4 (ANXA4) Antibody Pair Kit (with Standard)
MBS2103183-03 10x 96 Tests

Human Annexin A4 (ANXA4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Annexin A4 (ANXA4) Antibody Pair Kit (with Standard)
MBS2103183-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Annexin A4 (ANXA4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details