Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Leptin receptor overlapping transcript-like 1 (LEPROTL1)

This Recombinant Bovine Leptin receptor overlapping transcript-like 1 (LEPROTL1) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor overlapping transcript-like 1

UniProt

Q32PD8

Expression Region

1-131

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARANLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-sis Sheep ELISA Kit
B9756 96 Tests

C-sis Sheep ELISA Kit

Sign In for Pricing
View Details
Lentiviral human UMODL1 sgRNA gene knockout kit - Lentiviral human UMODL1 sgRNA gene knockout kit (25)
GTR15373104 1 Vial

Lentiviral human UMODL1 sgRNA gene knockout kit - Lentiviral human UMODL1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Cytochrome P450 17A1 Rabbit Polyclonal Antibody
orb101132-01 50 μL

Cytochrome P450 17A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 17A1 Rabbit Polyclonal Antibody
orb101132-02 100 µL

Cytochrome P450 17A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 17A1 Rabbit Polyclonal Antibody
orb101132-03 200 µL

Cytochrome P450 17A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCNE5 Human Pre-designed siRNA Set A
HY-RS07119 1 Set

KCNE5 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details