Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Leptin receptor overlapping transcript-like 1 (LEPROTL1)

This Recombinant Bovine Leptin receptor overlapping transcript-like 1 (LEPROTL1) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor overlapping transcript-like 1

UniProt

Q32PD8

Expression Region

1-131

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARANLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Protein lin-28 homolog A (LIN28A), partial
MBS7137048-01 0.02 mg (Mammalian-Cell)

Recombinant Human Protein lin-28 homolog A (LIN28A), partial

Sign In for Pricing
View Details
Recombinant Human Protein lin-28 homolog A (LIN28A), partial
MBS7137048-02 0.1 mg (Mammalian-Cell)

Recombinant Human Protein lin-28 homolog A (LIN28A), partial

Sign In for Pricing
View Details
Recombinant Human Protein lin-28 homolog A (LIN28A), partial
MBS7137048-03 1 mg (Mammalian-Cell)

Recombinant Human Protein lin-28 homolog A (LIN28A), partial

Sign In for Pricing
View Details
UBE2Z (Ubiquitin-conjugating Enzyme E2Z, FLJ13855, HOYS7, USE1) (MaxLight 550)
253223-ML550 100 µL

UBE2Z (Ubiquitin-conjugating Enzyme E2Z, FLJ13855, HOYS7, USE1) (MaxLight 550)

Sign In for Pricing
View Details
Syk, phosphorylated (Y348) (Tyrosine-Protein Kinase SYK, Spleen Tyrosine Kinase, p72-Syk, SYK)
226127 100 µL

Syk, phosphorylated (Y348) (Tyrosine-Protein Kinase SYK, Spleen Tyrosine Kinase, p72-Syk, SYK)

Sign In for Pricing
View Details
Adenosine Impurity 70
RM-A555970-01 10 mg

Adenosine Impurity 70

Sign In for Pricing
View Details