Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Deinococcus geothermalis Protein CrcB homolog 2 (crcB2)

This Recombinant Deinococcus geothermalis Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q1J3F4

Expression Region

1-131

Origin

Deinococcus geothermalis (strain DSM 11300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFWFGVAVGGALGALARYGVSLLVAGRLASTAWGNFPLATLLVNVLGSFLLAFITTLAL RGLVSPAWRLAVGTGFIGALTTFSTFAWESDLMVRDGEAARASLYVLGNLVLGYAAVLLG RALAARLGGGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-100 1x 100 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-100 1x 100 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (GM022), CF405S conjugate, 0.1mg/mL
BNC040874-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (GM022), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (r1415-1), CF680 conjugate, 0.1mg/mL
BNC801797-100 1x 100 µL

Histone H1 (Nuclear Marker) (r1415-1), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF640R conjugate, 0.1mg/mL
BNC400902-500 1x 500 µL

Nucleolin (NCL/902), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF568 conjugate, 0.1mg/mL
BNC681388-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details