Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q2FDW5

Expression Region

1-131

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Variola virus Protein A34 (A34R, A37R), partial
MBS7060991 Inquire

Recombinant Variola virus Protein A34 (A34R, A37R), partial

Sign In for Pricing
View Details
TFPT siRNA (Human)
orb1859019-01 15 nmol

TFPT siRNA (Human)

Sign In for Pricing
View Details
TFPT siRNA (Human)
orb1859019-02 30 nmol

TFPT siRNA (Human)

Sign In for Pricing
View Details
Fut2 (NM_031635) Rat Tagged Lenti ORF Clone
RR210375L4 10 µg

Fut2 (NM_031635) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PCDHGA8 ORF Vector (Human) (pORF)
36172011 1.0 µg DNA

PCDHGA8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
151080 Confined Space Covers
151080 1 Pack (1 Piece (s) x 1 Piece)

151080 Confined Space Covers

Sign In for Pricing
View Details