Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q5HD10

Expression Region

1-131

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (VWF635), Biotin conjugate, 0.1mg/mL
BNCB0635-100 1x 100 µL

Von Willebrand Factor (VWF635), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Monoclonal KvBeta1 Antibody (OTI7F12) [mFluor Violet 610 SE]
NBP2-71349MFV610 0.1 mL

Mouse Monoclonal KvBeta1 Antibody (OTI7F12) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
16- (tert-Butoxy) -16-oxohexadecanoic acid
OR303207-01 1 g

16- (tert-Butoxy) -16-oxohexadecanoic acid

Sign In for Pricing
View Details
16- (tert-Butoxy) -16-oxohexadecanoic acid
OR303207-02 5 g

16- (tert-Butoxy) -16-oxohexadecanoic acid

Sign In for Pricing
View Details
16- (tert-Butoxy) -16-oxohexadecanoic acid
OR303207-03 10 g

16- (tert-Butoxy) -16-oxohexadecanoic acid

Sign In for Pricing
View Details
1700016K19Rik Protein Vector (Mouse) (pPM-C-HA)
10165024 500 ng

1700016K19Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details