Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q5HD10

Expression Region

1-131

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-3/7 Inhibitor II
N-1995.0005 5.0mg

Caspase-3/7 Inhibitor II

Sign In for Pricing
View Details
Echdc1 siRNA Oligos set (Mouse)
18891174 3x 5 nmol

Echdc1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
GAD1 (D1F2M) Rabbit Monoclonal Antibody
CST 41318T 20 µL

GAD1 (D1F2M) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Goat Surfactant Associated Protein C (SP-C) ELISA Kit
NSL0147Gt 96 Tests

Goat Surfactant Associated Protein C (SP-C) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal RelA/NFkB p65 Antibody (PSH0-27)
NBP3-32648 100 µL

Rabbit Monoclonal RelA/NFkB p65 Antibody (PSH0-27)

Sign In for Pricing
View Details
RAIDD Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61003R-BF555-01 20 µL

RAIDD Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details