Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q5HD10

Expression Region

1-131

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (2-amino-1-thien-3-ylethyl) -N, N-diethylamine
sc-354192A 1 g

N- (2-amino-1-thien-3-ylethyl) -N, N-diethylamine

Sign In for Pricing
View Details
Recombinant Gossypium hirsutum DNA-directed RNA polymerase subunit beta (rpoB), partial
MBS1356029 Inquire

Recombinant Gossypium hirsutum DNA-directed RNA polymerase subunit beta (rpoB), partial

Sign In for Pricing
View Details
Cdk9 Antibody
N0146-01 50 µL

Cdk9 Antibody

Sign In for Pricing
View Details
Cdk9 Antibody
N0146-02 100 µL

Cdk9 Antibody

Sign In for Pricing
View Details
Cdk9 Antibody
N0146-03 200 µL

Cdk9 Antibody

Sign In for Pricing
View Details
FHIT Protein, Human, Recombinant (His Tag)
MBS8121687-01 0.1 mg

FHIT Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details