Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Leptin receptor gene-related protein (LEPROT)

This Recombinant Chicken Leptin receptor gene-related protein (LEPROT) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

Q5ZJD9

Expression Region

1-131

Origin

Gallus gallus (Chicken)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALVGLSFSGAIGLTFLMLGCALEYYGVYWPMFVLIFYFICPIPHFIARRVSDDSD AASSACRELAYFFTTGIVVSAFGFPIILARVEAIKWGACGLVLAGNAVIFLTILGFFLVF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Formyl Rifamycin
TRC-F700950-10MG 10 mg

3-Formyl Rifamycin

Sign In for Pricing
View Details
1-Ethylphenyl-1-nitroso Hydrazine
TRC-E860440-50MG 50 mg

1-Ethylphenyl-1-nitroso Hydrazine

Sign In for Pricing
View Details
MTF2 Human Gene Knockout Kit (CRISPR)
KN421006 1 Kit

MTF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF405S conjugate, 0.1mg/mL
BNC041175-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
G protein alpha 16 (GNA15) (NM_002068) Human Over-expression Lysate
LY419560 100 µg

G protein alpha 16 (GNA15) (NM_002068) Human Over-expression Lysate

Sign In for Pricing
View Details
Tacr1 Mouse Gene Knockout Kit (CRISPR)
KN517127 1 Kit

Tacr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details