Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Leptin receptor gene-related protein (LEPROT)

This Recombinant Chicken Leptin receptor gene-related protein (LEPROT) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

Q5ZJD9

Expression Region

1-131

Origin

Gallus gallus (Chicken)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALVGLSFSGAIGLTFLMLGCALEYYGVYWPMFVLIFYFICPIPHFIARRVSDDSD AASSACRELAYFFTTGIVVSAFGFPIILARVEAIKWGACGLVLAGNAVIFLTILGFFLVF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

fto Rabbit Polyclonal Antibody
TA376371 100 µL

fto Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: OTI7H2]
TA813775S 30 µL

Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: OTI7H2]

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF647 conjugate, 0.1mg/mL
BNC472488-100 1x 100 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHGDH Mouse Monoclonal Antibody [Clone ID: OTI4A1]
CF806782 100 µg

PHGDH Mouse Monoclonal Antibody [Clone ID: OTI4A1]

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS807686 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
MDBN
TRC-M199750-25MG 25 mg

MDBN

Sign In for Pricing
View Details