Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Leptin receptor gene-related protein (LEPROT)

This Recombinant Chicken Leptin receptor gene-related protein (LEPROT) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

Q5ZJD9

Expression Region

1-131

Origin

Gallus gallus (Chicken)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGIKALVGLSFSGAIGLTFLMLGCALEYYGVYWPMFVLIFYFICPIPHFIARRVSDDSD AASSACRELAYFFTTGIVVSAFGFPIILARVEAIKWGACGLVLAGNAVIFLTILGFFLVF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trichloroacetaldehyde Hydrate
TRC-T774055-50G 50 g

Trichloroacetaldehyde Hydrate

Sign In for Pricing
View Details
Zfp449 Mouse Gene Knockout Kit (CRISPR)
KN519841 1 Kit

Zfp449 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FGFR4 (NM_022963) Human Recombinant Protein
TP319813M 100 µg

FGFR4 (NM_022963) Human Recombinant Protein

Sign In for Pricing
View Details
T Box Protein 3 Antibody
KC-1696-01 50 μL

T Box Protein 3 Antibody

Sign In for Pricing
View Details
T Box Protein 3 Antibody
KC-1696-02 100 µL

T Box Protein 3 Antibody

Sign In for Pricing
View Details
T Box Protein 3 Antibody
KC-1696-03 1 mL

T Box Protein 3 Antibody

Sign In for Pricing
View Details