Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q6G6D3

Expression Region

1-131

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2F1 (E-10) Alexa Fluor® 546
sc-377499 AF546 200 µg/mL

CYP2F1 (E-10) Alexa Fluor® 546

Sign In for Pricing
View Details
RGD1306613 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6040105 3x 1.0 µg

RGD1306613 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ZNF444 Antibody
29-050 100 µL

ZNF444 Antibody

Sign In for Pricing
View Details
VPS35 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61829R-BF488 100 µL

VPS35 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Hsa-miR-4655-5p miRNA Antagomir
CIJ1455-01 10 nmol

Hsa-miR-4655-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-4655-5p miRNA Antagomir
CIJ1455-02 20 nmol

Hsa-miR-4655-5p miRNA Antagomir

Sign In for Pricing
View Details