Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q6G6D3

Expression Region

1-131

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LMW-PTPase (C-His)
BP2825-500ug 500 µg

Recombinant Human LMW-PTPase (C-His)

Sign In for Pricing
View Details
Lentiviral mouse Atp5l shRNA (UAS) - Lentiviral mouse Atp5l shRNA (UAS) plasmid
GTR15209935 1 Vial

Lentiviral mouse Atp5l shRNA (UAS) - Lentiviral mouse Atp5l shRNA (UAS) plasmid

Sign In for Pricing
View Details
PLVX-Tetone-Puro-LILRB2
PPL00316-4a 1 Each

PLVX-Tetone-Puro-LILRB2

Sign In for Pricing
View Details
Lentiviral human L3MBTL4 sgRNA gene knockout kit - Lentiviral human L3MBTL4 sgRNA gene knockout kit (25)
GTR15394410 1 Vial

Lentiviral human L3MBTL4 sgRNA gene knockout kit - Lentiviral human L3MBTL4 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
CD252 Antibody (Biotin)
abx200737-01 25 µg

CD252 Antibody (Biotin)

Sign In for Pricing
View Details
CD252 Antibody (Biotin)
abx200737-02 100 µg

CD252 Antibody (Biotin)

Sign In for Pricing
View Details