Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q6G6D3

Expression Region

1-131

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBP2a (Penicillin-Binding Protein 2a, Methicillin Resistant Staphylococcus Aureus, MRSA) (PE) discontinued
138207-PE 100 µL

PBP2a (Penicillin-Binding Protein 2a, Methicillin Resistant Staphylococcus Aureus, MRSA) (PE) discontinued

Sign In for Pricing
View Details
Human GPR34-Strep full length protein-synthetic nanodisc
MBS1883465-01 0.01 mg

Human GPR34-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human GPR34-Strep full length protein-synthetic nanodisc
MBS1883465-02 0.05 mg

Human GPR34-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human GPR34-Strep full length protein-synthetic nanodisc
MBS1883465-03 0.1 mg

Human GPR34-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
KIF4A Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62236R-BF555 100 µL

KIF4A Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
DR5 (TNFRSF10B) Human Over-expression Lysate
orb1357943 100 µg

DR5 (TNFRSF10B) Human Over-expression Lysate

Sign In for Pricing
View Details