Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q6GDQ7

Expression Region

1-131

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKQRKGIDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPK2, Recombinant, Human, GST-Tag (Receptor-interacting Serine/threonine-protein Kinase 2, RICK, RIP2, CARD3, CARDIAK, CCK, GIG30) discontinued
500423 10 µg

RIPK2, Recombinant, Human, GST-Tag (Receptor-interacting Serine/threonine-protein Kinase 2, RICK, RIP2, CARD3, CARDIAK, CCK, GIG30) discontinued

Sign In for Pricing
View Details
Recombinant Mouse Tnfrsf1a, His tagged
Tnfrsf1a-3306M 50 µg

Recombinant Mouse Tnfrsf1a, His tagged

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CBSX6 Polyclonal Antibody
MBS9003006 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CBSX6 Polyclonal Antibody

Sign In for Pricing
View Details
FGR Rabbit Polyclonal Antibody (Biotin)
orb2611982 100 µg

FGR Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
BICD2 Adenovirus (Rat)
13320057 1.0 mL

BICD2 Adenovirus (Rat)

Sign In for Pricing
View Details
40S ribosomal protein S28 (RPS28) Porcine ELISA Kit
B0925 96 Tests

40S ribosomal protein S28 (RPS28) Porcine ELISA Kit

Sign In for Pricing
View Details