Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q6GDQ7

Expression Region

1-131

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKQRKGIDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Collagen Alpha 2 (IX) chain (COL9A2) ELISA Kit
GTR10351728 96 Well

Bovine Collagen Alpha 2 (IX) chain (COL9A2) ELISA Kit

Sign In for Pricing
View Details
DUS4L, ID (DUS4L, tRNA-dihydrouridine (20a/20b) synthase [NAD (P) +]-like, pp35, tRNA-dihydrouridine synthase 4-like) (MaxLight 490) discontinued
034850-ML490 100 µL

DUS4L, ID (DUS4L, tRNA-dihydrouridine (20a/20b) synthase [NAD (P) +]-like, pp35, tRNA-dihydrouridine synthase 4-like) (MaxLight 490) discontinued

Sign In for Pricing
View Details
N-Boc-1H-indole-5-carbaldehyde
sc-295677 100 mg

N-Boc-1H-indole-5-carbaldehyde

Sign In for Pricing
View Details
Toripalimab (Anti-PDCD1 / PD-1 / CD279)
A3082-1mg*5 5x 1mg

Toripalimab (Anti-PDCD1 / PD-1 / CD279)

Sign In for Pricing
View Details
Anti-ATP4A Antibody Picoband® Fluoro488 Conjugated
A08198-1-Fluoro488 100 µg/Vial

Anti-ATP4A Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Asic5 Rat shRNA Plasmid (Locus ID 63866)
TR710605 1 Kit

Asic5 Rat shRNA Plasmid (Locus ID 63866)

Sign In for Pricing
View Details