Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

Q6GDQ7

Expression Region

1-131

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKQRKGIDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog/Canine Fas/APO-1 ELISA Kit
BG-CAN10934 1 Each

Dog/Canine Fas/APO-1 ELISA Kit

Sign In for Pricing
View Details
GLIS2 Polyclonal Antibody, PE Conjugated
bs-11566R-PE 100 µL

GLIS2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Lentiviral human AADACL2 sgRNA gene knockout kit - Lentiviral human AADACL2 sgRNA gene knockout kit (plasmid)
GTR15369242 1 Vial

Lentiviral human AADACL2 sgRNA gene knockout kit - Lentiviral human AADACL2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Human FAAP100 Protein Lysate
MBS8411338-01 0.02 mg

Human FAAP100 Protein Lysate

Sign In for Pricing
View Details
Human FAAP100 Protein Lysate
MBS8411338-02 5x 0.02 mg

Human FAAP100 Protein Lysate

Sign In for Pricing
View Details
4-Oxo Ascomycin
TRC-O781010-25MG 25 mg

4-Oxo Ascomycin

Sign In for Pricing
View Details