Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Leptin receptor gene-related protein (LEPROT)

This Recombinant Pig Leptin receptor gene-related protein (LEPROT) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

B9TRX0

Expression Region

1-131

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLVFHALSPIPHFIAKRATYDSD ATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLVF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ICAM-1 (15.2) In Vivo Antibody - Low Endotoxin
ICH1027-25mg 25 mg

Anti-ICAM-1 (15.2) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), Biotin conjugate, 0.1mg/mL
BNCB2561-500 1x 500 µL

NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (MS4A1) (NM_021950) Human Over-expression Lysate
LC402889 20 µg

CD20 (MS4A1) (NM_021950) Human Over-expression Lysate

Sign In for Pricing
View Details
Sprouty 4 (SPRY4) pTyr75 Rabbit Polyclonal Antibody
AP12995PU-N 400 µL

Sprouty 4 (SPRY4) pTyr75 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SRP9 Human Gene Knockout Kit (CRISPR)
KN421573 1 Kit

SRP9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/1882), 0.2mg/mL
BNUB1882-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/1882), 0.2mg/mL

Sign In for Pricing
View Details