Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Leptin receptor gene-related protein (LEPROT)

This Recombinant Pig Leptin receptor gene-related protein (LEPROT) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

B9TRX0

Expression Region

1-131

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLVFHALSPIPHFIAKRATYDSD ATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLVF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Pancreas
CS650752 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
Cytokeratin 18 (DC10), CF488A conjugate, 0.1mg/mL
BNC880021-500 1x 500 µL

Cytokeratin 18 (DC10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ZNF514 activation kit by CRISPRa
GA113731 1 Kit

Human ZNF514 activation kit by CRISPRa

Sign In for Pricing
View Details
CYP2R1 Rabbit Polyclonal Antibody
AP14747PU-N 400 µL

CYP2R1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ketohexokinase (KHK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C3]
TA501328AM 100 µL

ketohexokinase (KHK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C3]

Sign In for Pricing
View Details
FKBP51 (FKBP5) (NM_001145776) Human Over-expression Lysate
LY429003 100 µg

FKBP51 (FKBP5) (NM_001145776) Human Over-expression Lysate

Sign In for Pricing
View Details