Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Leptin receptor gene-related protein (LEPROT)

This Recombinant Pig Leptin receptor gene-related protein (LEPROT) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

B9TRX0

Expression Region

1-131

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLVFHALSPIPHFIAKRATYDSD ATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLVF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBE1 Polyclonal Antibody
E-AB-67593-01 60 µL

HBE1 Polyclonal Antibody

Sign In for Pricing
View Details
HBE1 Polyclonal Antibody
E-AB-67593-02 120 µL

HBE1 Polyclonal Antibody

Sign In for Pricing
View Details
HBE1 Polyclonal Antibody
E-AB-67593-03 200 µL

HBE1 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS805024 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
c Kit (KIT) Mouse Monoclonal Antibody [Clone ID: 8D7]
AM06162SU-N 100 µL

c Kit (KIT) Mouse Monoclonal Antibody [Clone ID: 8D7]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB602814 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details