Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leptin receptor gene-related protein (LEPROT)

This Recombinant Human Leptin receptor gene-related protein (LEPROT) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, Leptin receptor overlapping transcript protein, OB-R gene-related protein, OB-RGRP

UniProt

O15243

Expression Region

1-131

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSD ATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pembrolizumab Biosimilar - Research Grade
ICH4029-100mg 100 mg

Pembrolizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
4-tert-Butylphenethanol
TRC-B540680-5G 5 g

4-tert-Butylphenethanol

Sign In for Pricing
View Details
Human EphA2 Recombinant Rabbit monoclonal Antibody
HA723715 100 µL

Human EphA2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD147 (BSG/963), CF647 conjugate, 0.1mg/mL
BNC470963-500 1x 500 µL

CD147 (BSG/963), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
gamma-Linolenic Acid Ethyl Ester
TRC-L467680-250MG 250 mg

gamma-Linolenic Acid Ethyl Ester

Sign In for Pricing
View Details
Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R03-8H1]
TA421537 100 µL

Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R03-8H1]

Sign In for Pricing
View Details