Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leptin receptor gene-related protein (LEPROT)

This Recombinant Human Leptin receptor gene-related protein (LEPROT) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, Leptin receptor overlapping transcript protein, OB-R gene-related protein, OB-RGRP

UniProt

O15243

Expression Region

1-131

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSD ATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Txnip Mouse Gene Knockout Kit (CRISPR)
KN518517 1 Kit

Txnip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS709922 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
BCAS3 Rabbit Polyclonal Antibody
TA370165 100 µL

BCAS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VIP Recombinant Chimeric Antibody Antibody
HA610241 100 µg

VIP Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
PI3 Kinase p110α Recombinant Rabbit Monoclonal Antibody [SJ0186]
ET1606-36 100 µL

PI3 Kinase p110α Recombinant Rabbit Monoclonal Antibody [SJ0186]

Sign In for Pricing
View Details
CD70 (TNFS7/1026), CF568 conjugate, 0.1mg/mL
BNC681026-100 1x 100 µL

CD70 (TNFS7/1026), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details