Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leptin receptor gene-related protein (LEPROT)

This Recombinant Human Leptin receptor gene-related protein (LEPROT) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, Leptin receptor overlapping transcript protein, OB-R gene-related protein, OB-RGRP

UniProt

O15243

Expression Region

1-131

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSD ATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL11 (NM_000975) Human Over-expression Lysate
LY424421 100 µg

RPL11 (NM_000975) Human Over-expression Lysate

Sign In for Pricing
View Details
Spink4 Mouse Gene Knockout Kit (CRISPR)
KN516618 1 Kit

Spink4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Stigmasta-3,5-diene
TRC-S686745-5MG 5 mg

Stigmasta-3,5-diene

Sign In for Pricing
View Details
HMGA1 Polyclonal Antibody
E-AB-65951-01 60 µL

HMGA1 Polyclonal Antibody

Sign In for Pricing
View Details
HMGA1 Polyclonal Antibody
E-AB-65951-02 120 µL

HMGA1 Polyclonal Antibody

Sign In for Pricing
View Details
HMGA1 Polyclonal Antibody
E-AB-65951-03 200 µL

HMGA1 Polyclonal Antibody

Sign In for Pricing
View Details