Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leptin receptor gene-related protein (Leprot)

This Recombinant Mouse Leptin receptor gene-related protein (Leprot) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Leptin receptor gene-related protein, OB-R gene-related protein, OB-RGRP

UniProt

O89013

Expression Region

1-131

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSD ATSSACRELAYFFTTGIVVSAFGLPVVLARVDVIKWGACGLVLAGNAVIFLTIQGFFLVF GRGDDFSWEQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycyl-l-alanine
TRC-G720113-250MG 250 mg

Glycyl-l-alanine

Sign In for Pricing
View Details
ICAM1 Antibody
KC-6280-01 50 μL

ICAM1 Antibody

Sign In for Pricing
View Details
ICAM1 Antibody
KC-6280-02 100 µL

ICAM1 Antibody

Sign In for Pricing
View Details
ICAM1 Antibody
KC-6280-03 1 mL

ICAM1 Antibody

Sign In for Pricing
View Details
TEC Rabbit Polyclonal Antibody
TA382406 100 µL

TEC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 26B (CYP26B1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A8]
TA811497BM 100 µL

Cytochrome P450 26B (CYP26B1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A8]

Sign In for Pricing
View Details